PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NP_001280200.1
Common NamePm74
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 295aa    MW: 33941.1 Da    PI: 8.0934
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NP_001280200.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.98.1e-5381321128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeelv++yL++k++++++++  +i+e+d+yk++PwdLp  +  +ekewyfFs+rd+ky++g+r+nra+ sgyWkatg dk++ s 
  NP_001280200.1   8 LPPGFRFHPTDEELVKHYLCRKCQSQPISV-PIIAEIDLYKYNPWDLPGLALYGEKEWYFFSPRDRKYPNGSRPNRAAGSGYWKATGADKPIGS- 100
                     79****************************.88***************6555679*************************************99. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                       + vg+kk Lvfy g+ap+gekt+W+mheyrl
  NP_001280200.1 101 -PKPVGIKKALVFYAGKAPRGEKTNWIMHEYRL 132
                     .789***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.63E-635159IPR003441NAC domain
PROSITE profilePS5100561.0618159IPR003441NAC domain
PfamPF023653.5E-289132IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009611Biological Processresponse to wounding
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MSSSDLQLPP GFRFHPTDEE LVKHYLCRKC QSQPISVPII AEIDLYKYNP WDLPGLALYG  60
EKEWYFFSPR DRKYPNGSRP NRAAGSGYWK ATGADKPIGS PKPVGIKKAL VFYAGKAPRG  120
EKTNWIMHEY RLADVDRSPR KKSSSLRLDD WVLCRIYNKK GTVEKQQQQQ QQQQQQTTSR  180
MSSGSEFEDR KPENLACPPP PAAVAPTRPN DYVYFDTSDS VPRLHTDSSC SEHVVSPEFT  240
CEVQSEPKWK EWEKALDFNY NYMDTSVENG FGPQFQSANQ MSPLQDIFMY LQKPY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-8121659174Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00121DAPTransfer from AT1G01720Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2187890.0AB218789.1 Prunus mume Pm74 mRNA for NAC family protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001280200.10.0NAC domain-containing protein 2
SwissprotQ390131e-151NAC2_ARATH; NAC domain-containing protein 2
TrEMBLQ2Z1Y10.0Q2Z1Y1_PRUMU; NAC family protein
STRINGPOPTR_0002s08150.11e-160(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF125834108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-140NAC family protein